PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g29480
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 288aa    MW: 32422.6 Da    PI: 4.5643
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g29480genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.61.4e-2066119356
                 --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 k++++++eq++ Le+ Fe ++++  e++++LA+klgL+ rqV vWFqNrRa++k
  CA02g29480  66 KKRRLSPEQVHLLEKSFEAENKLEPERKTQLAQKLGLQPRQVAVWFQNRRARWK 119
                 56789************************************************9 PP

2HD-ZIP_I/II135.32.1e-4365156192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  ekkrrls eqv+lLE+sFe+e+kLeperK++la++LglqprqvavWFqnrRAR+ktkqlE+dy++Lk++yd+l ++ ++++k++++L++e+ 
   CA02g29480  65 EKKRRLSPEQVHLLEKSFEAENKLEPERKTQLAQKLGLQPRQVAVWFQNRRARWKTKQLERDYDQLKSSYDSLLSDFDSIRKDNDQLKSEIV 156
                  69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.76E-2053123IPR009057Homeodomain-like
PROSITE profilePS5007118.28561121IPR001356Homeobox domain
SMARTSM003895.1E-2064125IPR001356Homeobox domain
PfamPF000469.2E-1866119IPR001356Homeobox domain
CDDcd000868.91E-2066122No hitNo description
Gene3DG3DSA:1.10.10.607.3E-2267128IPR009057Homeodomain-like
PRINTSPR000314.4E-692101IPR000047Helix-turn-helix motif
PROSITE patternPS00027096119IPR017970Homeobox, conserved site
PRINTSPR000314.4E-6101117IPR000047Helix-turn-helix motif
PfamPF021831.6E-17121163IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001558Biological Processregulation of cell growth
GO:0009637Biological Processresponse to blue light
GO:0009651Biological Processresponse to salt stress
GO:0009965Biological Processleaf morphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MGSGHIFFDP SSCHGNMLFL GNGDPLFRGP RSSMLKMEDS SKRRPFFSSP EELYDEEYYD  60
EQSPEKKRRL SPEQVHLLEK SFEAENKLEP ERKTQLAQKL GLQPRQVAVW FQNRRARWKT  120
KQLERDYDQL KSSYDSLLSD FDSIRKDNDQ LKSEIVSLME KLQGKVVGGS VVNEKSEALE  180
VDALTTLQVK VKTEDRLSSG SGGSAVVDEH SPQLVDSGDS YFHSTIDHEE YPGPGGCNIP  240
PPVDGLQSEE DDGSDDGSCH GYFSNAFVAS EEHHHEEGEE PLGWFWS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113121RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00323DAPTransfer from AT3G01470Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM9022880.0AM902288.1 Solanum lycopersicum mRNA for homeodomain leucine zipper protein (hb-1 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016561539.10.0PREDICTED: homeobox-leucine zipper protein HAT5
SwissprotQ022838e-96HAT5_ARATH; Homeobox-leucine zipper protein HAT5
TrEMBLM0ZIA10.0M0ZIA1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000013220.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA78912330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.12e-80homeobox 1